PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C007330P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 389aa    MW: 44583 Da    PI: 6.0751
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C007330P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.24.4e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+d+++++G g+W+t ++  g+ R++k+c++rw +yl
   MELO3C007330P1 14 KGPWTPEEDQKLIDYIQKHGYGNWRTLPKNAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding54.33e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE+e +++++  lG++ W++Ia++++ gRt++++k++w+++
   MELO3C007330P1  67 RGRFSFEEEETIIQLHSILGNK-WSAIAARLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-26564IPR009057Homeodomain-like
PROSITE profilePS5129425.799965IPR017930Myb domain
SuperFamilySSF466893.19E-3211108IPR009057Homeodomain-like
SMARTSM007174.9E-141363IPR001005SANT/Myb domain
PfamPF002494.2E-171461IPR001005SANT/Myb domain
CDDcd001674.41E-131661No hitNo description
Gene3DG3DSA:1.10.10.602.6E-2665116IPR009057Homeodomain-like
PROSITE profilePS5129420.4666116IPR017930Myb domain
SMARTSM007171.8E-1666114IPR001005SANT/Myb domain
PfamPF002491.3E-1567111IPR001005SANT/Myb domain
CDDcd001672.74E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MGRTPCCEKE GLKKGPWTPE EDQKLIDYIQ KHGYGNWRTL PKNAGLQRCG KSCRLRWTNY  60
LRPDIKRGRF SFEEEETIIQ LHSILGNKWS AIAARLPGRT DNEIKNYWNT HIRKRLLRMG  120
IDPVTHNPRL DLLDLSSILG SSFYNNNSPN SQINNFSRLI GIHNSTINPE VLRFASSFIT  180
SNSLSQHHTP NFLLQNVDQN QEQYSQMIIS HLQLQEQQPQ HQIDPSSALP PLHEVSAGCS  240
PSTTTSYGGE PHYYHSSGHQ LLFQSSSNFT TDFYSQNCQH PNDEMASINN NMNGFNYSSL  300
EEFQSYGFYG SHEERERERE QEQFHEQIME ASPETSTLNS SSTPLNSNST YFSTTNGNGT  360
DQDDRESYCS QFFKFEFSDF LDVNPAFM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-31121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818750.0LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
GenBankLN7132620.0LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008439917.10.0PREDICTED: transcription factor MYB34-like
TrEMBLA0A0A0KLC51e-146A0A0A0KLC5_CUCSA; Uncharacterized protein
STRINGVIT_00s0203g00070.t011e-116(Vitis vinifera)
STRINGGLYMA15G07230.11e-116(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85034127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.19e-95MYB-like 102